No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Mouse |
Applications | WB-Ti,WB-Tr |
Brand: | Abnova |
Reference: | H00009056-B01P |
Product name: | SLC7A7 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human SLC7A7 protein. |
Gene id: | 9056 |
Gene name: | SLC7A7 |
Gene alias: | LAT3|LPI|MOP-2|Y+LAT1|y+LAT-1 |
Gene description: | solute carrier family 7 (cationic amino acid transporter, y+ system), member 7 |
Genbank accession: | BC003062.2 |
Immunogen: | SLC7A7 (AAH03062.1, 1 a.a. ~ 511 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MVDSTEYEVASQPEVETSPLGDGASPGPEQVKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIYSASFGLSLVIWAVGGLFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAIIAITFANYMVQPLFPSCFAPYAASRLLAAACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDIALALYSALFSYSGWDTLNYVTEEIKNPERNLPLSIGISMPIVTIIYILTNVAYYTVLDMRDILASDAVAVTFADQIFGIFNWIIPLSVALSCFGGLNASIVAASRLFFVGSREGHLPDAICMIHVERFTPVPSLLFNGIMALIYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRWKEPDRPRPLKLSVFFPIVFCLCTIFLVAVPLYSDTINSLIGIAIALSGLPFYFLIIRVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN |
Protein accession: | AAH03062.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![]() |
Application image note: | Western Blot analysis of SLC7A7 expression in transfected 293T cell line (H00009056-T01) by SLC7A7 MaxPab polyclonal antibody. Lane1:SLC7A7 transfected lysate(56.21 KDa). Lane2:Non-transfected lysate. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Arginine transport in human monocytic leukemia THP-1 cells during macrophage differentiation.Barilli A, Rotoli BM, Visigalli R, Bussolati O, Gazzola GC, Dall'asta V. J Leukoc Biol. 2011 May 17. [Epub ahead of print] |