No products
Prices are tax excluded
Brand | Abnova |
Product type | Proteins |
Host species | Wheat Germ (in vitro) |
Applications | AP,Array,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00009043-P01 |
Product name: | SPAG9 (Human) Recombinant Protein (P01) |
Product description: | Human SPAG9 full-length ORF ( AAH07524, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 9043 |
Gene name: | SPAG9 |
Gene alias: | FLJ13450|FLJ14006|FLJ26141|FLJ34602|HLC4|JLP|KIAA0516|MGC117291|MGC14967|MGC74461|PHET|PIG6 |
Gene description: | sperm associated antigen 9 |
Genbank accession: | BC007524 |
Immunogen sequence/protein sequence: | MSPGCMLLFVFGFVGGAVVINSAILVSLSVLLLVHFSISTGVPALTQNLPRILRKERPISLGIFPLPAGDGLLTPDAQKGGETPGSEQWKFQELSQPRSHTSLKVSNSPEPQKAVEQEVRMVLLNTLQKVY |
Protein accession: | AAH07524 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: | ![]() |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | The expression of DAMP proteins HSP70 and cancer-testis antigen SPAG9 in peripheral blood of patients with HCC and lung cancer.Ren B, Luo S, Xu F, Zou G, Xu G, He J, Huang Y, Zhu H, Li Y. Cell Stress Chaperones. 2016 Dec 27. [Epub ahead of print] |