Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of UBE2M monoclonal antibody (M01), clone 3C4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
More info about UBE2M monoclonal antibody (M01), clone 3C4
| Brand: | Abnova |
| Reference: | H00009040-M01 |
| Product name: | UBE2M monoclonal antibody (M01), clone 3C4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant UBE2M. |
| Clone: | 3C4 |
| Isotype: | IgG1 kappa |
| Gene id: | 9040 |
| Gene name: | UBE2M |
| Gene alias: | UBC-RS2|UBC12|hUbc12 |
| Gene description: | ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast) |
| Genbank accession: | BC058924 |
| Immunogen: | UBE2M (AAH58924, 1 a.a. ~ 183 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK |
| Protein accession: | AAH58924 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (45.87 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to UBE2M on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Application of an integrated physical and functional screening approach to identify inhibitors of the Wnt pathway.Miller BW, Lau G, Grouios C, Mollica E, Barrios-Rodiles M, Liu Y, Datti A, Morris Q, Wrana JL, Attisano L. Molecular Systems Biology 5; Article number 315; doi:10.1038 /msb.2009.72 |