Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PKD2L1 monoclonal antibody (M01), clone 4F9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ti,ELISA,WB-Re |
More info about PKD2L1 monoclonal antibody (M01), clone 4F9
| Brand: | Abnova |
| Reference: | H00009033-M01 |
| Product name: | PKD2L1 monoclonal antibody (M01), clone 4F9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PKD2L1. |
| Clone: | 4F9 |
| Isotype: | IgG2b Kappa |
| Gene id: | 9033 |
| Gene name: | PKD2L1 |
| Gene alias: | PCL|PKD2L|PKDL |
| Gene description: | polycystic kidney disease 2-like 1 |
| Genbank accession: | NM_016112 |
| Immunogen: | PKD2L1 (NP_057196.2, 173 a.a. ~ 272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KWYNNQSLGHGSHSFIYYENMLLGVPRLRQLKVRNDSCVVHEDFREDILSCYDVYSPDKEEQLPFGPFNGTAWTYHSQDELGGFSHWGRLTSYSGGGYYL |
| Protein accession: | NP_057196.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | PKD2L1 monoclonal antibody (M01), clone 4F9. Western Blot analysis of PKD2L1 expression in rat brain. |
| Applications: | WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A novel PKD2L1 C-terminal domain critical for trimerization and channel function.Zheng W, Hussein S, Yang J, Huang J, Zhang F, Hernandez-Anzaldo S, Fernandez-Patron C, Cao Y, Zeng H, Tang J, Chen XZ Sci Rep. 2015 Mar 30;5:9460. doi: 10.1038/srep09460. |