| Brand: | Abnova |
| Reference: | H00009031-M01A |
| Product name: | BAZ1B monoclonal antibody (M01A), clone 5E9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant BAZ1B. |
| Clone: | 5E9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9031 |
| Gene name: | BAZ1B |
| Gene alias: | WBSCR10|WBSCR9|WSTF |
| Gene description: | bromodomain adjacent to zinc finger domain, 1B |
| Genbank accession: | NM_023005 |
| Immunogen: | BAZ1B (NP_075381, 1384 a.a. ~ 1483 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYVRRKRKKFPDRLAEDEGDSEPEAVGQSRGRRQKK |
| Protein accession: | NP_075381 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |