| Brand: | Abnova |
| Reference: | H00009026-M01 |
| Product name: | HIP1R monoclonal antibody (M01), clone 3E10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HIP1R. |
| Clone: | 3E10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 9026 |
| Gene name: | HIP1R |
| Gene alias: | FLJ14000|FLJ27022|HIP12|HIP3|ILWEQ|KIAA0655|MGC47513 |
| Gene description: | huntingtin interacting protein 1 related |
| Genbank accession: | NM_003959 |
| Immunogen: | HIP1R (NP_003950, 969 a.a. ~ 1066 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SGLSLIKLKKQEMETQVRVLELEKTLEAERMRLGELRKQHYVLAGASGSPGEEVAIRPSTAPRSVTTKKPPLAQKPSVAPRQDHQLDKKDGIYPAQLV |
| Protein accession: | NP_003950 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | HIP1R monoclonal antibody (M01), clone 3E10 Western Blot analysis of HIP1R expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |