No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00009023-M01 |
Product name: | CH25H monoclonal antibody (M01), clone 1G8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CH25H. |
Clone: | 1G8 |
Isotype: | IgG2b Kappa |
Gene id: | 9023 |
Gene name: | CH25H |
Gene alias: | C25H |
Gene description: | cholesterol 25-hydroxylase |
Genbank accession: | BC017843 |
Immunogen: | CH25H (AAH17843.1, 142 a.a. ~ 247 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | WHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSVWELFSLGFFDMMNVTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFN |
Protein accession: | AAH17843.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.29 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |