| Brand: | Abnova |
| Reference: | H00009023-A01 |
| Product name: | CH25H polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CH25H. |
| Gene id: | 9023 |
| Gene name: | CH25H |
| Gene alias: | C25H |
| Gene description: | cholesterol 25-hydroxylase |
| Genbank accession: | NM_003956 |
| Immunogen: | CH25H (NP_003947, 206 a.a. ~ 272 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | VNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFNCNFAPYFTHWDKILGTLRTASVPAR |
| Protein accession: | NP_003947 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.48 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Increased 25-hydroxycholesterol concentrations in the lungs of patients with chronic obstructive pulmonary disease.Sugiura H, Koarai A, Ichikawa T, Minakata Y, Matsunaga K, Hirano T, Akamatsu K, Yanagisawa S, Furusawa M, Uno Y, Yamasaki M, Satomi Y, Ichinose M. Respirology. 2012 Feb 1. doi: 10.1111/j.1440-1843.2012.02136.x. [Epub ahead of print] |