| Brand: | Abnova |
| Reference: | H00009021-M03 |
| Product name: | SOCS3 monoclonal antibody (M03), clone 1F6 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant SOCS3. |
| Clone: | 1F6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9021 |
| Gene name: | SOCS3 |
| Gene alias: | ATOD4|CIS3|Cish3|MGC71791|SOCS-3|SSI-3|SSI3 |
| Gene description: | suppressor of cytokine signaling 3 |
| Genbank accession: | BC060858 |
| Immunogen: | SOCS3 (AAH60858, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL |
| Protein accession: | AAH60858 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SOCS3 is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |