View larger

SLC25A14 monoclonal antibody (M01), clone 1C12

Reference:

Condition: New product

Data sheet of SLC25A14 monoclonal antibody (M01), clone 1C12

Brand:	Abnova
Reference:	H00009016-M01
Product name:	SLC25A14 monoclonal antibody (M01), clone 1C12
Product description:	Mouse monoclonal antibody raised against a full-length recombinant SLC25A14.
Clone:	1C12
Isotype:	IgG1 Kappa
Gene id:	9016
Gene name:	SLC25A14
Gene alias:	BMCP1\|MGC149543\|UCP5
Gene description:	solute carrier family 25 (mitochondrial carrier, brain), member 14
Genbank accession:	NM_003951.2
Immunogen:	SLC25A14 (NP_003942.1, 1 a.a. ~ 325 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	MGIFPGIILIFLRVKFATAAVIVSGHQKSTTVSHEMSGLNWKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQGSMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLILSGMMGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQI
Protein accession:	NP_003942.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA
Shipping condition:	Dry Ice