Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TAF1C monoclonal antibody (M02), clone 3E6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about TAF1C monoclonal antibody (M02), clone 3E6
| Brand: | Abnova |
| Reference: | H00009013-M02 |
| Product name: | TAF1C monoclonal antibody (M02), clone 3E6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TAF1C. |
| Clone: | 3E6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9013 |
| Gene name: | TAF1C |
| Gene alias: | MGC:39976|SL1|TAFI110|TAFI95 |
| Gene description: | TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kDa |
| Genbank accession: | NM_005679 |
| Immunogen: | TAF1C (NP_005670.2, 761 a.a. ~ 869 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SLSGHVDPSEDTSSPHSPEWPPADALPLPPTTPPSQELTPDACAQGVPSEQRQMLRDYMAKLPPQRDTPGCATTPPHSQASSVRATRSQQHTPVLSSSQPLRKKPRMGF |
| Protein accession: | NP_005670.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of TAF1C expression in transfected 293T cell line by TAF1C monoclonal antibody (M02), clone 3E6. Lane 1: TAF1C transfected lysate(85.1 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |