View larger

CDKL2 monoclonal antibody (M02), clone 6H8

Reference:

Condition: New product

Data sheet of CDKL2 monoclonal antibody (M02), clone 6H8

Brand:	Abnova
Reference:	H00008999-M02
Product name:	CDKL2 monoclonal antibody (M02), clone 6H8
Product description:	Mouse monoclonal antibody raised against a partial recombinant CDKL2.
Clone:	6H8
Isotype:	IgG1 Kappa
Gene id:	8999
Gene name:	CDKL2
Gene alias:	KKIAMRE\|P56
Gene description:	cyclin-dependent kinase-like 2 (CDC2-related kinase)
Genbank accession:	NM_003948
Immunogen:	CDKL2 (NP_003939, 394 a.a. ~ 493 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	LKDCSNVSVDHTRNPSVAIPPLTHNLSAVAPSINSGMGTETIPIQGYRVDEKTKKCSIPFVKPNRHSPSGIYNINVTTLVSGPPLSDDSGADLPQMEHQH
Protein accession:	NP_003939
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.63 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Immunofluorescence of monoclonal antibody to CDKL2 on HeLa cell . [antibody concentration 10 ug/ml]
Applications:	IF,ELISA,WB-Re
Shipping condition:	Dry Ice