| Brand: | Abnova |
| Reference: | H00008995-M28 |
| Product name: | TNFSF18 monoclonal antibody (M28), clone 3F6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFSF18. |
| Clone: | 3F6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 8995 |
| Gene name: | TNFSF18 |
| Gene alias: | AITRL|GITRL|MGC138237|TL6|hGITRL |
| Gene description: | tumor necrosis factor (ligand) superfamily, member 18 |
| Genbank accession: | BC069111.1 |
| Immunogen: | TNFSF18 (AAH69111.1, 50 a.a. ~ 177 a.a) partial recombinant protein. |
| Immunogen sequence/protein sequence: | QLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS |
| Protein accession: | AAH69111.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |