TNFSF18 MaxPab mouse polyclonal antibody (B01) View larger

TNFSF18 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNFSF18 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about TNFSF18 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00008995-B01
Product name: TNFSF18 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human TNFSF18 protein.
Gene id: 8995
Gene name: TNFSF18
Gene alias: AITRL|GITRL|MGC138237|TL6|hGITRL
Gene description: tumor necrosis factor (ligand) superfamily, member 18
Genbank accession: NM_005092
Immunogen: TNFSF18 (NP_005083, 1 a.a. ~ 177 a.a) full-length human protein.
Immunogen sequence/protein sequence: MCLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFLCSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
Protein accession: NP_005083
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008995-B01-13-15-1.jpg
Application image note: Western Blot analysis of TNFSF18 expression in transfected 293T cell line (H00008995-T01) by TNFSF18 MaxPab polyclonal antibody.

Lane 1: TNFSF18 transfected lysate(19.47 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TNFSF18 MaxPab mouse polyclonal antibody (B01) now

Add to cart