No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00008989-M03 |
Product name: | TRPA1 monoclonal antibody (M03), clone 6G8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TRPA1. |
Clone: | 6G8 |
Isotype: | IgG1 Kappa |
Gene id: | 8989 |
Gene name: | TRPA1 |
Gene alias: | ANKTM1 |
Gene description: | transient receptor potential cation channel, subfamily A, member 1 |
Genbank accession: | NM_007332 |
Immunogen: | TRPA1 (NP_015628, 1033 a.a. ~ 1117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | IPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHL |
Protein accession: | NP_015628 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.09 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged TRPA1 is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Transient receptor potential ankyrin 1 channel involved in atherosclerosis and macrophage-foam cell formation.Zhao JF, Shyue SK, Kou YR, Lu TS, Lee TS. Int J Biol Sci 2016; 12(7):812-823. |