| Brand: | Abnova |
| Reference: | H00008934-M03 |
| Product name: | RAB7L1 monoclonal antibody (M03), clone 2B8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant RAB7L1. |
| Clone: | 2B8 |
| Isotype: | IgG2b Kappa |
| Gene id: | 8934 |
| Gene name: | RAB7L1 |
| Gene alias: | DKFZp686P1051|RAB7L |
| Gene description: | RAB7, member RAS oncogene family-like 1 |
| Genbank accession: | BC002585 |
| Immunogen: | RAB7L1 (AAH02585, 1 a.a. ~ 203 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSCC |
| Protein accession: | AAH02585 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (48.07 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | RAB7L1 monoclonal antibody (M03), clone 2B8 Western Blot analysis of RAB7L1 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |