FOXH1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

FOXH1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FOXH1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about FOXH1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00008928-D01P
Product name: FOXH1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human FOXH1 protein.
Gene id: 8928
Gene name: FOXH1
Gene alias: FAST-1|FAST1
Gene description: forkhead box H1
Genbank accession: BC111604
Immunogen: FOXH1 (AAI11605.1, 1 a.a. ~ 365 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGPCSGSRLGPPEAESPSQPPKRRKKRYLRHDKPPYTYLAMIALVIQAAPSRRLKLAQIIRQVQAVFPFFREDYEGWKDSIRHNLSSNRCFRKVPKDPAKPQAKGNFWAVDVSLIPAEALRLQNTALCRRWQNGGARGAFAKDLGPYVLHGRPYRPPSPPPPPSEGFSIKSLLGGSGEGAPWPGLAPQSSPVPAGTGNSGEEAVPTPPLPSSERPLWPLCPLPGPTRVEGETVQGGAIGPSTLSPEPRAWPLHLLQGTAVPGGRSSGGHRASLWGQLPTSYLPIYTPNVVMPLAPPPTSCPQCPSTSPAYWGVAPETRGPPGLLCDLDALFQGVPPNKSIYDVWVSHPRDLAAPGPGWLLSWCSL
Protein accession: AAI11605.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00008928-D01P-13-15-1.jpg
Application image note: Western Blot analysis of FOXH1 expression in transfected 293T cell line (H00008928-T01) by FOXH1 MaxPab polyclonal antibody.

Lane 1: FOXH1 transfected lysate(40.15 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Buy FOXH1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart