TIMELESS polyclonal antibody (A01) View larger

TIMELESS polyclonal antibody (A01)

New product

286,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TIMELESS polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about TIMELESS polyclonal antibody (A01)

Brand: Abnova
Reference: H00008914-A01
Product name: TIMELESS polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant TIMELESS.
Gene id: 8914
Gene name: TIMELESS
Gene alias: FLJ12640|FLJ20714|TIM|TIM1|hTIM
Gene description: timeless homolog (Drosophila)
Genbank accession: NM_003920
Immunogen: TIMELESS (NP_003911, 1109 a.a. ~ 1207 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: PELQPKVPGEQGSDEEHCKEHRAQALRALLLAHKKKAGLASPEEEDAVGKEPLKAAPKKRQLLDSDEEQEEDEGRNRAPELGAPGIQKKKRYQIEDDED
Protein accession: NP_003911
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008914-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Buy TIMELESS polyclonal antibody (A01) now

Add to cart