CACNA1I (Human) Recombinant Protein (Q01) View larger

CACNA1I (Human) Recombinant Protein (Q01)

New product

374,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CACNA1I (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about CACNA1I (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00008911-Q01
Product name: CACNA1I (Human) Recombinant Protein (Q01)
Product description: Human CACNA1I partial ORF ( NP_066919, 233 a.a. - 331 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 8911
Gene name: CACNA1I
Gene alias: Cav3.3|KIAA1120
Gene description: calcium channel, voltage-dependent, T type, alpha 1I subunit
Genbank accession: NM_021096
Immunogen sequence/protein sequence: GLLRNRCFLEENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDVYDFGAGRQDLNASGLCVNWNRYYNVCRTGSA
Protein accession: NP_066919
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00008911-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Related products: - TIMELESS (Human) Recombinant Protein (Q01)
- BCL10 (Human) Recombinant Protein (P01)
- HERC3 (Human) Recombinant Protein (Q01)
- MBD4 (Human) Recombinant Protein (P02)
- MBD4 (Human) Recombinant Protein (Q01)
Shipping condition: Dry Ice

Buy CACNA1I (Human) Recombinant Protein (Q01) now

Add to cart