Login to display prices
Login to display prices
P11 (Human) Recombinant Protein (Q01) View larger

P11 (Human) Recombinant Protein (Q01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of P11 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Origin speciesHuman
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about P11 (Human) Recombinant Protein (Q01)

Reference: H00008909-Q01
Product name: P11 (Human) Recombinant Protein (Q01)
Product description: Human P11 partial ORF ( NP_006016.1, 270 a.a. - 369 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 8909
Gene name: P11
Gene alias: MGC133268|PP11|PRSS26
Gene description: 26 serine protease
Genbank accession: NM_006025
Immunogen sequence/protein sequence: EGLVDYYSHIYDGPWDSYPDVLAMQFNWDGYYKEVGSAFIGSSPEFEFALYSLCFIARPGKVCQLSLGGYPLAVRTYTWDKSTYGNGKKYIATAYIVSST
Protein accession: NP_006016.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Shipping condition: Dry Ice

30 other products in the same category: