Login to display prices
Login to display prices
P11 monoclonal antibody (M01), clone 2H1 View larger

P11 monoclonal antibody (M01), clone 2H1

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of P11 monoclonal antibody (M01), clone 2H1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about P11 monoclonal antibody (M01), clone 2H1

Reference: H00008909-M01
Product name: P11 monoclonal antibody (M01), clone 2H1
Product description: Mouse monoclonal antibody raised against a partial recombinant P11.
Clone: 2H1
Isotype: IgG2a Kappa
Gene id: 8909
Gene name: P11
Gene alias: MGC133268|PP11|PRSS26
Gene description: 26 serine protease
Genbank accession: NM_006025
Immunogen: P11 (NP_006016.1, 270 a.a. ~ 369 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EGLVDYYSHIYDGPWDSYPDVLAMQFNWDGYYKEVGSAFIGSSPEFEFALYSLCFIARPGKVCQLSLGGYPLAVRTYTWDKSTYGNGKKYIATAYIVSST
Protein accession: NP_006016.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: