Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GYG2 monoclonal antibody (M04), clone 3D10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about GYG2 monoclonal antibody (M04), clone 3D10
| Brand: | Abnova |
| Reference: | H00008908-M04 |
| Product name: | GYG2 monoclonal antibody (M04), clone 3D10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GYG2. |
| Clone: | 3D10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8908 |
| Gene name: | GYG2 |
| Gene alias: | GN-2|GN2 |
| Gene description: | glycogenin 2 |
| Genbank accession: | NM_003918 |
| Immunogen: | GYG2 (NP_003909, 392 a.a. ~ 501 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CDPLSQPSPQPADFTETETILQPANKVESVSSEETFEPSQELPAEALRDPSLQDALEVDLAVSVSQISIEEKVKELSPEEERRKWEEGRIDYMGKDAFARIQEKLDRFLQ |
| Protein accession: | NP_003909 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of GYG2 expression in transfected 293T cell line by GYG2 monoclonal antibody (M04), clone 3D10. Lane 1: GYG2 transfected lysate(55.212 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | LC-MS/MS characterization of combined glycogenin-1 and glycogenin-2 enzymatic activities reveals their self-glucosylation preferences.Nilsson J, Halim A, Larsson E, Moslemi AR, Oldfors A, Larson G, Nilsson J Biochim Biophys Acta. 2013 Nov 14;1844(2):398-405. doi: 10.1016/j.bbapap.2013.11.002. |