GYG2 monoclonal antibody (M04), clone 3D10 View larger

GYG2 monoclonal antibody (M04), clone 3D10

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GYG2 monoclonal antibody (M04), clone 3D10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about GYG2 monoclonal antibody (M04), clone 3D10

Brand: Abnova
Reference: H00008908-M04
Product name: GYG2 monoclonal antibody (M04), clone 3D10
Product description: Mouse monoclonal antibody raised against a partial recombinant GYG2.
Clone: 3D10
Isotype: IgG2a Kappa
Gene id: 8908
Gene name: GYG2
Gene alias: GN-2|GN2
Gene description: glycogenin 2
Genbank accession: NM_003918
Immunogen: GYG2 (NP_003909, 392 a.a. ~ 501 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CDPLSQPSPQPADFTETETILQPANKVESVSSEETFEPSQELPAEALRDPSLQDALEVDLAVSVSQISIEEKVKELSPEEERRKWEEGRIDYMGKDAFARIQEKLDRFLQ
Protein accession: NP_003909
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008908-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008908-M04-13-15-1.jpg
Application image note: Western Blot analysis of GYG2 expression in transfected 293T cell line by GYG2 monoclonal antibody (M04), clone 3D10.

Lane 1: GYG2 transfected lysate(55.212 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: LC-MS/MS characterization of combined glycogenin-1 and glycogenin-2 enzymatic activities reveals their self-glucosylation preferences.Nilsson J, Halim A, Larsson E, Moslemi AR, Oldfors A, Larson G, Nilsson J
Biochim Biophys Acta. 2013 Nov 14;1844(2):398-405. doi: 10.1016/j.bbapap.2013.11.002.

Buy GYG2 monoclonal antibody (M04), clone 3D10 now

Add to cart