GYG2 purified MaxPab rabbit polyclonal antibody (D01P) View larger

GYG2 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GYG2 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,WB-Ti,WB-Tr

More info about GYG2 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00008908-D01P
Product name: GYG2 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human GYG2 protein.
Gene id: 8908
Gene name: GYG2
Gene alias: GN-2|GN2
Gene description: glycogenin 2
Genbank accession: BC023152.1
Immunogen: GYG2 (AAH23152.1, 1 a.a. ~ 470 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSVTDQAFVTLATNDIYCQGALVLGQSLRRHRLTRKLVVLITPQVSSLLRVILSKVFDEVIEVNLIDSADYIHLAFLKRPELGLTLTKLHCWTLTHYSKCVFLDADTLVLSNVDELFDRGEFSAAPDPGWPDCFNSGVFVFQPSLHTHKLLLQHAMEHGSFDGADQGLLNSFFRNWSTTDIHKHLPFIYNLSSNTMYTYSPAFKQFGSSAKVVHFLGSMKPWNYKYNPQSGSVLEQGSVSSSQHQAAFLHLWWTVYQNNVLPLYKSVQAGEARASPGHTLCRSDVGGPCADSASGVGEPCENSTPSAGVPCANSPLGSNQPAQGLPEPTQIVDETLSLPEGRRSEDMIACPETETPAVITCDPLSQPSPQPADFTETETILQPANKVESVSSEETFEPSQELPAEALRDPSLQDALEVDLAVSVSQISIEEKVKELSPEEERRKWEEGRIDYMGKDAFARIQEKLDRFLQ
Protein accession: AAH23152.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00008908-D01P-2-A1-1.jpg
Application image note: GYG2 MaxPab rabbit polyclonal antibody. Western Blot analysis of GYG2 expression in human liver.
Applications: WB-Ce,WB-Ti,WB-Tr
Related products: - SGCE purified MaxPab mouse polyclonal antibody (B01P)
- SGCE purified MaxPab rabbit polyclonal antibody (D01P)
- TIMELESS polyclonal antibody (A01)
- TIMELESS purified MaxPab mouse polyclonal antibody (B01P)
- TIMELESS MaxPab rabbit polyclonal antibody (D01)
Shipping condition: Dry Ice

Buy GYG2 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart