GYG2 MaxPab mouse polyclonal antibody (B01) View larger

GYG2 MaxPab mouse polyclonal antibody (B01)

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GYG2 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about GYG2 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00008908-B01
Product name: GYG2 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human GYG2 protein.
Gene id: 8908
Gene name: GYG2
Gene alias: GN-2|GN2
Gene description: glycogenin 2
Genbank accession: BC023152.1
Immunogen: GYG2 (AAH23152.1, 1 a.a. ~ 470 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSVTDQAFVTLATNDIYCQGALVLGQSLRRHRLTRKLVVLITPQVSSLLRVILSKVFDEVIEVNLIDSADYIHLAFLKRPELGLTLTKLHCWTLTHYSKCVFLDADTLVLSNVDELFDRGEFSAAPDPGWPDCFNSGVFVFQPSLHTHKLLLQHAMEHGSFDGADQGLLNSFFRNWSTTDIHKHLPFIYNLSSNTMYTYSPAFKQFGSSAKVVHFLGSMKPWNYKYNPQSGSVLEQGSVSSSQHQAAFLHLWWTVYQNNVLPLYKSVQAGEARASPGHTLCRSDVGGPCADSASGVGEPCENSTPSAGVPCANSPLGSNQPAQGLPEPTQIVDETLSLPEGRRSEDMIACPETETPAVITCDPLSQPSPQPADFTETETILQPANKVESVSSEETFEPSQELPAEALRDPSLQDALEVDLAVSVSQISIEEKVKELSPEEERRKWEEGRIDYMGKDAFARIQEKLDRFLQ
Protein accession: AAH23152.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008908-B01-13-15-1.jpg
Application image note: Western Blot analysis of GYG2 expression in transfected 293T cell line (H00008908-T01) by GYG2 MaxPab polyclonal antibody.

Lane 1: GYG2 transfected lysate(51.7 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Related products: - GYG2 purified MaxPab mouse polyclonal antibody (B01P)
- GYG2 purified MaxPab rabbit polyclonal antibody (D01P)
- SGCE purified MaxPab mouse polyclonal antibody (B01P)
- SGCE purified MaxPab rabbit polyclonal antibody (D01P)
- TIMELESS polyclonal antibody (A01)
Shipping condition: Dry Ice

Buy GYG2 MaxPab mouse polyclonal antibody (B01) now

Add to cart