AP1M1 (Human) Recombinant Protein (Q01) View larger

AP1M1 (Human) Recombinant Protein (Q01)

New product

374,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AP1M1 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about AP1M1 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00008907-Q01
Product name: AP1M1 (Human) Recombinant Protein (Q01)
Product description: Human AP1M1 partial ORF ( NP_115882, 1 a.a. - 74 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 8907
Gene name: AP1M1
Gene alias: AP47|CLAPM2|CLTNM|MU-1A
Gene description: adaptor-related protein complex 1, mu 1 subunit
Genbank accession: NM_032493
Immunogen sequence/protein sequence: MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKN
Protein accession: NP_115882
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00008907-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Buy AP1M1 (Human) Recombinant Protein (Q01) now

Add to cart