AP1M1 polyclonal antibody (A01) View larger

AP1M1 polyclonal antibody (A01)

New product

286,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AP1M1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about AP1M1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00008907-A01
Product name: AP1M1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant AP1M1.
Gene id: 8907
Gene name: AP1M1
Gene alias: AP47|CLAPM2|CLTNM|MU-1A
Gene description: adaptor-related protein complex 1, mu 1 subunit
Genbank accession: NM_032493
Immunogen: AP1M1 (NP_115882, 1 a.a. ~ 74 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKN
Protein accession: NP_115882
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008907-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.25 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008907-A01-1-23-1.jpg
Application image note: AP1M1 polyclonal antibody (A01), Lot # 060717JCS1 Western Blot analysis of AP1M1 expression in U-2 OS ( Cat # L022V1 ).
Applications: WB-Ce,ELISA,WB-Re
Related products: - GYG2 MaxPab mouse polyclonal antibody (B01)
- GYG2 purified MaxPab mouse polyclonal antibody (B01P)
- GYG2 purified MaxPab rabbit polyclonal antibody (D01P)
- SGCE purified MaxPab mouse polyclonal antibody (B01P)
- SGCE purified MaxPab rabbit polyclonal antibody (D01P)
Shipping condition: Dry Ice
Publications: Human kidney anion exchanger 1 interacts with adaptor-related protein complex 1 u1A (AP-1 mu1A).Sawasdee N, Junking M, Ngaojanlar P, Sukomon N, Ungsupravate D, Limjindaporn T, Akkarapatumwong V, Noisakran S, Yenchitsomanus PT.
Biochem Biophys Res Commun. 2010 Oct 8;401(1):85-91. Epub 2010 Sep 15.

Buy AP1M1 polyclonal antibody (A01) now

Add to cart