Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of AP1M1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about AP1M1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00008907-A01 |
| Product name: | AP1M1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant AP1M1. |
| Gene id: | 8907 |
| Gene name: | AP1M1 |
| Gene alias: | AP47|CLAPM2|CLTNM|MU-1A |
| Gene description: | adaptor-related protein complex 1, mu 1 subunit |
| Genbank accession: | NM_032493 |
| Immunogen: | AP1M1 (NP_115882, 1 a.a. ~ 74 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKN |
| Protein accession: | NP_115882 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.25 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | AP1M1 polyclonal antibody (A01), Lot # 060717JCS1 Western Blot analysis of AP1M1 expression in U-2 OS ( Cat # L022V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Human kidney anion exchanger 1 interacts with adaptor-related protein complex 1 u1A (AP-1 mu1A).Sawasdee N, Junking M, Ngaojanlar P, Sukomon N, Ungsupravate D, Limjindaporn T, Akkarapatumwong V, Noisakran S, Yenchitsomanus PT. Biochem Biophys Res Commun. 2010 Oct 8;401(1):85-91. Epub 2010 Sep 15. |