Login to display prices
Login to display prices
AP1G2 polyclonal antibody (A01) View larger

AP1G2 polyclonal antibody (A01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AP1G2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsELISA,WB-Re

More info about AP1G2 polyclonal antibody (A01)

Reference: H00008906-A01
Product name: AP1G2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant AP1G2.
Gene id: 8906
Gene name: AP1G2
Gene alias: G2AD
Gene description: adaptor-related protein complex 1, gamma 2 subunit
Genbank accession: NM_003917
Immunogen: AP1G2 (NP_003908, 686 a.a. ~ 785 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: RPPENPALLLITITATNFSEGDVTHFICQAAVPKSLQLQLQAPSGNTVPARGGLPITQLFRILNPNKAPLRLKLRLTYDHFHQSVQEIFEVNNLPVESWQ
Protein accession: NP_003908
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: