Login to display prices
Login to display prices
AP1S2 (Human) Recombinant Protein (P01) View larger

AP1S2 (Human) Recombinant Protein (P01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AP1S2 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Origin speciesHuman
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about AP1S2 (Human) Recombinant Protein (P01)

Reference: H00008905-P01
Product name: AP1S2 (Human) Recombinant Protein (P01)
Product description: Human AP1S2 full-length ORF ( AAH01117, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 8905
Gene name: AP1S2
Gene alias: DC22|MGC:1902|MRX59|SIGMA1B
Gene description: adaptor-related protein complex 1, sigma 2 subunit
Genbank accession: BC001117
Immunogen sequence/protein sequence: MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT
Protein accession: AAH01117
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Shipping condition: Dry Ice

30 other products in the same category: