Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00008905-M01 |
Product name: | AP1S2 monoclonal antibody (M01), clone 3B9-G5 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant AP1S2. |
Clone: | 3B9-G5 |
Isotype: | IgG2b kappa |
Gene id: | 8905 |
Gene name: | AP1S2 |
Gene alias: | DC22|MGC:1902|MRX59|SIGMA1B |
Gene description: | adaptor-related protein complex 1, sigma 2 subunit |
Genbank accession: | BC001117 |
Immunogen: | AP1S2 (AAH01117, 1 a.a. ~ 157 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT |
Protein accession: | AAH01117 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged AP1S2 is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Related products: | - GYG2 monoclonal antibody (M04), clone 3D10 - P11 monoclonal antibody (M01), clone 2H1 - CACNA1I monoclonal antibody (M01), clone 2F5 - CACNA1I monoclonal antibody (M02), clone 3H5 - HERC3 monoclonal antibody (M01), clone 2C1 |
Shipping condition: | Dry Ice |