AP1S2 polyclonal antibody (A01) View larger

AP1S2 polyclonal antibody (A01)

New product

286,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AP1S2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about AP1S2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00008905-A01
Product name: AP1S2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a full-length recombinant AP1S2.
Gene id: 8905
Gene name: AP1S2
Gene alias: DC22|MGC:1902|MRX59|SIGMA1B
Gene description: adaptor-related protein complex 1, sigma 2 subunit
Genbank accession: BC001117
Immunogen: AP1S2 (AAH01117, 1 a.a. ~ 157 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT
Protein accession: AAH01117
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008905-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (43.38 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Buy AP1S2 polyclonal antibody (A01) now

Add to cart