Login to display prices
Login to display prices
CPNE1 monoclonal antibody (M01), clone 8B8 View larger

CPNE1 monoclonal antibody (M01), clone 8B8

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CPNE1 monoclonal antibody (M01), clone 8B8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about CPNE1 monoclonal antibody (M01), clone 8B8

Reference: H00008904-M01
Product name: CPNE1 monoclonal antibody (M01), clone 8B8
Product description: Mouse monoclonal antibody raised against a partial recombinant CPNE1.
Clone: 8B8
Isotype: IgG2a Kappa
Gene id: 8904
Gene name: CPNE1
Gene alias: COPN1|CPN1|MGC1142
Gene description: copine I
Genbank accession: NM_003915
Immunogen: CPNE1 (NP_003906, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TLPLMLKPGKPAGRGTITVSAQELKDNRVVTMEVEARNLDKKDFLGKSDPFLEFFRQGDGKWHLVYRSEVIKNNLNPTWKRFSVPVQHFCGGNPSTPIQV
Protein accession: NP_003906
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: