CPNE1 polyclonal antibody (A01) View larger

CPNE1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CPNE1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CPNE1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00008904-A01
Product name: CPNE1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CPNE1.
Gene id: 8904
Gene name: CPNE1
Gene alias: COPN1|CPN1|MGC1142
Gene description: copine I
Genbank accession: NM_003915
Immunogen: CPNE1 (NP_003906, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: TLPLMLKPGKPAGRGTITVSAQELKDNRVVTMEVEARNLDKKDFLGKSDPFLEFFRQGDGKWHLVYRSEVIKNNLNPTWKRFSVPVQHFCGGNPSTPIQV
Protein accession: NP_003906
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008904-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Related products: - CPNE1 MaxPab mouse polyclonal antibody (B01)
- CPNE1 purified MaxPab mouse polyclonal antibody (B01P)
- CPNE1 MaxPab rabbit polyclonal antibody (D01)
- CPNE1 purified MaxPab rabbit polyclonal antibody (D01P)
- AP1S2 polyclonal antibody (A01)
Shipping condition: Dry Ice

Buy CPNE1 polyclonal antibody (A01) now

Add to cart