CCNA1 (Human) Recombinant Protein (P01) View larger

CCNA1 (Human) Recombinant Protein (P01)

New product

374,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CCNA1 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about CCNA1 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00008900-P01
Product name: CCNA1 (Human) Recombinant Protein (P01)
Product description: Human CCNA1 full-length ORF ( AAH36346, 1 a.a. - 464 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 8900
Gene name: CCNA1
Gene alias: -
Gene description: cyclin A1
Genbank accession: BC036346
Immunogen sequence/protein sequence: METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQPVESEAMHCSNPKSGVVLATVARGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYEEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ
Protein accession: AAH36346
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00008900-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Related products: - CPNE1 (Human) Recombinant Protein (P01)
- CPNE1 (Human) Recombinant Protein (Q01)
- AP1S2 (Human) Recombinant Protein (P01)
- AP1G2 (Human) Recombinant Protein (Q01)
- AP1M1 (Human) Recombinant Protein (Q01)
Shipping condition: Dry Ice

Buy CCNA1 (Human) Recombinant Protein (P01) now

Add to cart