Login to display prices
Login to display prices
CCNA1 monoclonal antibody (M02), clone 4A11-5B5 View larger

CCNA1 monoclonal antibody (M02), clone 4A11-5B5

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CCNA1 monoclonal antibody (M02), clone 4A11-5B5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,PLA-Ce

More info about CCNA1 monoclonal antibody (M02), clone 4A11-5B5

Reference: H00008900-M02
Product name: CCNA1 monoclonal antibody (M02), clone 4A11-5B5
Product description: Mouse monoclonal antibody raised against a full length recombinant CCNA1.
Clone: 4A11-5B5
Isotype: IgG1 Kappa
Gene id: 8900
Gene name: CCNA1
Gene alias: -
Gene description: cyclin A1
Genbank accession: BC036346
Immunogen: CCNA1 (AAH36346, 1 a.a. ~ 464 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQPVESEAMHCSNPKSGVVLATVARGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYEEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ
Protein accession: AAH36346
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: