Login to display prices
Login to display prices
PRPF4B (Human) Recombinant Protein (Q02) View larger

PRPF4B (Human) Recombinant Protein (Q02)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRPF4B (Human) Recombinant Protein (Q02)

BrandAbnova
Product typeProteins
Origin speciesHuman
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about PRPF4B (Human) Recombinant Protein (Q02)

Reference: H00008899-Q02
Product name: PRPF4B (Human) Recombinant Protein (Q02)
Product description: Human PRPF4B partial ORF ( NP_003904.2, 898 a.a. - 1005 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 8899
Gene name: PRPF4B
Gene alias: KIAA0536|PR4H|PRP4|PRP4H|PRP4K|dJ1013A10.1
Gene description: PRP4 pre-mRNA processing factor 4 homolog B (yeast)
Genbank accession: NM_003913
Immunogen sequence/protein sequence: LKLAMDLKGKMPNKMIRKGVFKDQHFDQNLNFMYIEVDKVTEREKVTVMSTINPTKDLLADLIGCQRLPEDQRKKVHQLKDLLDQILMLDPAKRISINQALQHAFIQE
Protein accession: NP_003904.2
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Shipping condition: Dry Ice

30 other products in the same category: