No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00008897-M07A |
| Product name: | MTMR3 monoclonal antibody (M07A), clone 1E11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MTMR3. |
| Clone: | 1E11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8897 |
| Gene name: | MTMR3 |
| Gene alias: | FLJ32333|FYVE-DSP1|KIAA0371|ZFYVE10 |
| Gene description: | myotubularin related protein 3 |
| Genbank accession: | NM_021090 |
| Immunogen: | MTMR3 (NP_066576.1, 579 a.a. ~ 674 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CPSPTTPVDDSCAPYPAPGTSPDDPPLSRLPKTRSYDNLTTACDNTVPLASRRCSDPSLNEKWQEHRRSLELSSLAGPGEDPLSADSLGKPTRVPG |
| Protein accession: | NP_066576.1 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.3 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of MTMR3 expression in transfected 293T cell line by MTMR3 monoclonal antibody (M07A), clone 1E11. Lane 1: MTMR3 transfected lysate(133.6 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |