Login to display prices
Login to display prices
MTMR3 monoclonal antibody (M07), clone 1E11 View larger

MTMR3 monoclonal antibody (M07), clone 1E11

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MTMR3 monoclonal antibody (M07), clone 1E11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about MTMR3 monoclonal antibody (M07), clone 1E11

Reference: H00008897-M07
Product name: MTMR3 monoclonal antibody (M07), clone 1E11
Product description: Mouse monoclonal antibody raised against a partial recombinant MTMR3.
Clone: 1E11
Isotype: IgG2a Kappa
Gene id: 8897
Gene name: MTMR3
Gene alias: FLJ32333|FYVE-DSP1|KIAA0371|ZFYVE10
Gene description: myotubularin related protein 3
Genbank accession: NM_021090
Immunogen: MTMR3 (NP_066576.1, 579 a.a. ~ 674 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CPSPTTPVDDSCAPYPAPGTSPDDPPLSRLPKTRSYDNLTTACDNTVPLASRRCSDPSLNEKWQEHRRSLELSSLAGPGEDPLSADSLGKPTRVPG
Protein accession: NP_066576.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: