No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,WB-Tr |
Brand: | Abnova |
Reference: | H00008896-B02P |
Product name: | BUD31 purified MaxPab mouse polyclonal antibody (B02P) |
Product description: | Mouse polyclonal antibody raised against a full-length human BUD31 protein. |
Gene id: | 8896 |
Gene name: | BUD31 |
Gene alias: | EDG-2|EDG2|G10|MGC111202|YCR063W|fSAP17 |
Gene description: | BUD31 homolog (S. cerevisiae) |
Genbank accession: | NM_003910.2 |
Immunogen: | BUD31 (NP_003901.2, 1 a.a. ~ 144 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG |
Protein accession: | NP_003901.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of BUD31 expression in transfected 293T cell line (H00008896-T02) by BUD31 MaxPab polyclonal antibody. Lane 1: G10 transfected lysate(15.84 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,WB-Tr |
Shipping condition: | Dry Ice |