Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of G10 MaxPab mouse polyclonal antibody (B01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host species | Mouse |
| Applications | WB-Tr |
More info about G10 MaxPab mouse polyclonal antibody (B01)
| Reference: | H00008896-B01 |
| Product name: | G10 MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human G10 protein. |
| Gene id: | 8896 |
| Gene name: | BUD31 |
| Gene alias: | EDG-2|EDG2|G10|MGC111202|YCR063W|fSAP17 |
| Gene description: | BUD31 homolog (S. cerevisiae) |
| Genbank accession: | BC022821 |
| Immunogen: | G10 (AAH22821, 1 a.a. ~ 144 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG |
| Protein accession: | AAH22821 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Shipping condition: | Dry Ice |