Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EIF2S2 monoclonal antibody (M09), clone 2F3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about EIF2S2 monoclonal antibody (M09), clone 2F3
| Brand: | Abnova |
| Reference: | H00008894-M09 |
| Product name: | EIF2S2 monoclonal antibody (M09), clone 2F3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EIF2S2. |
| Clone: | 2F3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 8894 |
| Gene name: | EIF2S2 |
| Gene alias: | DKFZp686L18198|EIF2|EIF2B|EIF2beta|MGC8508 |
| Gene description: | eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa |
| Genbank accession: | NM_003908 |
| Immunogen: | EIF2S2 (NP_003899.2, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKD |
| Protein accession: | NP_003899.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | EIF2S2 monoclonal antibody (M09), clone 2F3. Western Blot analysis of EIF2S2 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |