| Brand: | Abnova |
| Reference: | H00008882-M01 |
| Product name: | ZNF259 monoclonal antibody (M01), clone 6F7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNF259. |
| Clone: | 6F7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8882 |
| Gene name: | ZNF259 |
| Gene alias: | MGC110983|ZPR1 |
| Gene description: | zinc finger protein 259 |
| Genbank accession: | NM_003904 |
| Immunogen: | ZNF259 (NP_003895, 361 a.a. ~ 459 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IRELVTKNPFTLGDSSNPGQTERLQEFSQKMDQIIEGNMKAHFIMDDPAGNSYLQNVYAPEDDPEMKVERYKRTFDQNEELGLNDMKTEGYEAGLAPQR |
| Protein accession: | NP_003895 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to ZNF259 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |