No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00008880-M02 |
Product name: | FUBP1 monoclonal antibody (M02), clone 2H3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FUBP1. |
Clone: | 2H3 |
Isotype: | IgG2a Kappa |
Gene id: | 8880 |
Gene name: | FUBP1 |
Gene alias: | FBP|FUBP |
Gene description: | far upstream element (FUSE) binding protein 1 |
Genbank accession: | NM_003902 |
Immunogen: | FUBP1 (NP_003893, 27 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VNDAFKDALQRARQIAAKIGGDAGTSLNSNDYGYGGQKRPLEDGDQPDAKKVAPQNDSFGTQLPPMHQQQSRSVMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQI |
Protein accession: | NP_003893 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunofluorescence of monoclonal antibody to FUBP1 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |