| Brand: | Abnova |
| Reference: | H00008876-M05 |
| Product name: | VNN1 monoclonal antibody (M05), clone 2B10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant VNN1. |
| Clone: | 2B10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8876 |
| Gene name: | VNN1 |
| Gene alias: | HDLCQ8|MGC116930|MGC116931|MGC116932|MGC116933|Tiff66 |
| Gene description: | vanin 1 |
| Genbank accession: | NM_004666 |
| Immunogen: | VNN1 (NP_004657, 298 a.a. ~ 397 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KLLLSQLDSHPSHSAVVNWTSYASSIEALSSGNKEFKGTVFFDEFTFVKLTGVAGNYTVCQKDLCCHLSYKMSENIPNEVYALGAFDGLHTVEGRYYLQI |
| Protein accession: | NP_004657 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged VNN1 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,IP |
| Shipping condition: | Dry Ice |