| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ti,IF,WB-Tr |
| Brand: | Abnova |
| Reference: | H00008856-B01P |
| Product name: | NR1I2 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human NR1I2 protein. |
| Gene id: | 8856 |
| Gene name: | NR1I2 |
| Gene alias: | BXR|ONR1|PAR|PAR1|PAR2|PARq|PRR|PXR|SAR|SXR |
| Gene description: | nuclear receptor subfamily 1, group I, member 2 |
| Genbank accession: | NM_003889.2 |
| Immunogen: | NR1I2 (NP_003880.3, 1 a.a. ~ 434 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS |
| Protein accession: | NP_003880.3 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of NR1I2 expression in transfected 293T cell line (H00008856-T01) by NR1I2 MaxPab polyclonal antibody. Lane 1: NR1I2 transfected lysate(47.74 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,IF,WB-Tr |
| Shipping condition: | Dry Ice |