No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Mouse |
Applications | WB-Ti,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00008856-A01 |
Product name: | NR1I2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant NR1I2. |
Gene id: | 8856 |
Gene name: | NR1I2 |
Gene alias: | BXR|ONR1|PAR|PAR1|PAR2|PARq|PRR|PXR|SAR|SXR |
Gene description: | nuclear receptor subfamily 1, group I, member 2 |
Genbank accession: | BC017304 |
Immunogen: | NR1I2 (AAH17304, 279 a.a. ~ 378 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | LHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS |
Protein accession: | AAH17304 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![]() |
Application image note: | NR1I2 polyclonal antibody (A01). Western Blot analysis of NR1I2 expression in rat adipocytes. |
Applications: | WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |