No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00008850-M05 |
Product name: | PCAF monoclonal antibody (M05), clone 5E8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PCAF. |
Clone: | 5E8 |
Isotype: | IgG2a Kappa |
Gene id: | 8850 |
Gene name: | KAT2B |
Gene alias: | CAF|P|P/CAF|PCAF |
Gene description: | K(lysine) acetyltransferase 2B |
Genbank accession: | BC060823 |
Immunogen: | PCAF (AAH60823, 353 a.a. ~ 452 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSGLEANPGEKRKMTDSHVLEEAKKPRVMGDIPME |
Protein accession: | AAH60823 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | PCAF monoclonal antibody (M05), clone 5E8. Western Blot analysis of PCAF expression in human uterus myoma. |
Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |