| Brand: | Abnova |
| Reference: | H00008848-D01 |
| Product name: | TSC22D1 MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human TSC22D1 protein. |
| Gene id: | 8848 |
| Gene name: | TSC22D1 |
| Gene alias: | DKFZp686O19206|MGC17597|RP11-269C23.2|TGFB1I4|TSC22 |
| Gene description: | TSC22 domain family, member 1 |
| Genbank accession: | NM_006022.2 |
| Immunogen: | TSC22D1 (NP_006013.1, 1 a.a. ~ 144 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA |
| Protein accession: | NP_006013.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TSC22D1 MaxPab rabbit polyclonal antibody. Western Blot analysis of TSC22D1 expression in Hela S3 NE. |
| Applications: | WB-Ce,WB-Tr,IP |
| Shipping condition: | Dry Ice |