Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PROM1 monoclonal antibody (M08), clone 2F4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about PROM1 monoclonal antibody (M08), clone 2F4
| Brand: | Abnova |
| Reference: | H00008842-M08 |
| Product name: | PROM1 monoclonal antibody (M08), clone 2F4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PROM1. |
| Clone: | 2F4 |
| Isotype: | IgG2b Kappa |
| Gene id: | 8842 |
| Gene name: | PROM1 |
| Gene alias: | AC133|CD133|MSTP061|PROML1|RP41 |
| Gene description: | prominin 1 |
| Genbank accession: | NM_006017 |
| Immunogen: | PROM1 (NP_006008, 693 a.a. ~ 790 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | STLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDP |
| Protein accession: | NP_006008 |
| Storage buffer: | In 1x PBS, pH 7.2 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged PROM1 is 1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Dual-targeting immunoliposomes using angiopep-2 and CD133 antibody for glioblastoma stem cells.Kim JS, Shin DH, Kim JS. J Control Release. 2017 Nov 21;269:245-257. |