No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00008842-M08 |
Product name: | PROM1 monoclonal antibody (M08), clone 2F4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PROM1. |
Clone: | 2F4 |
Isotype: | IgG2b Kappa |
Gene id: | 8842 |
Gene name: | PROM1 |
Gene alias: | AC133|CD133|MSTP061|PROML1|RP41 |
Gene description: | prominin 1 |
Genbank accession: | NM_006017 |
Immunogen: | PROM1 (NP_006008, 693 a.a. ~ 790 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | STLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDP |
Protein accession: | NP_006008 |
Storage buffer: | In 1x PBS, pH 7.2 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged PROM1 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |
Publications: | Dual-targeting immunoliposomes using angiopep-2 and CD133 antibody for glioblastoma stem cells.Kim JS, Shin DH, Kim JS. J Control Release. 2017 Nov 21;269:245-257. |