No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA,IP |
Brand: | Abnova |
Reference: | H00008841-M01 |
Product name: | HDAC3 monoclonal antibody (M01), clone 2F9-4B7 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant HDAC3. |
Clone: | 2F9-4B7 |
Isotype: | IgG1 Kappa |
Gene id: | 8841 |
Gene name: | HDAC3 |
Gene alias: | HD3|RPD3|RPD3-2 |
Gene description: | histone deacetylase 3 |
Genbank accession: | BC000614 |
Immunogen: | HDAC3 (AAH00614, 1 a.a. ~ 428 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI |
Protein accession: | AAH00614 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged HDAC3 is 1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,IP |
Shipping condition: | Dry Ice |