No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA |
Brand: | Abnova |
Reference: | H00008841-A01 |
Product name: | HDAC3 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant HDAC3. |
Gene id: | 8841 |
Gene name: | HDAC3 |
Gene alias: | HD3|RPD3|RPD3-2 |
Gene description: | histone deacetylase 3 |
Genbank accession: | BC000614 |
Immunogen: | HDAC3 (AAH00614, 1 a.a. ~ 428 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI |
Protein accession: | AAH00614 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |